제품 > 항체 > 단일클론항체(mAb)

MEK1/MEK2 Rabbit mAb (A24394)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HeLa cells, using MEK1/MEK2 Rabbit mAb (A24394) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - MEK1/MEK2 Rabbit mAb (A24394)

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using MEK1/MEK2 Rabbit mAb (A24394) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	MEK1/MEK2 Rabbit mAb
Catalog No.	A24394
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59805

Background

The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development. [provided by RefSeq, Jul 2008]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 170-270of human MEK1/MEK2 (NP_002746.1).
Sequence	SIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKE
Gene ID
Swiss Prot
Synonyms	CFC3; MAPKK1; MEK1; MKK1; PRKMK1; MEK1/MEK2
Calculated MW	44kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:100 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa
Cellular location	cytosol, early endosome, endoplasmic reticulum, focal adhesion, Golgi apparatus, late endosome, microtubule organizing center, mitochondrion, nucleus, plasma membrane.
Customer validation	WB(Other)