Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MEK1/MEK2 Rabbit mAb |
---|---|
Catalog No. | A24394 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC59805 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 170-270of human MEK1/MEK2 (NP_002746.1). |
---|---|
Sequence | SIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKE |
Gene ID | |
Swiss Prot | |
Synonyms | CFC3; MAPKK1; MEK1; MKK1; PRKMK1; MEK1/MEK2 |
Calculated MW | 44kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa |
Cellular location | cytosol, early endosome, endoplasmic reticulum, focal adhesion, Golgi apparatus, late endosome, microtubule organizing center, mitochondrion, nucleus, plasma membrane. |
Customer validation | WB(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A24394? Please let us know so that we can cite the reference in this datasheet.