제품 > 항체 > 다중클론항체(pAb)

MEK1/MEK2 Rabbit pAb (A18117)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of lysates from PC-12 cells, using MEK1/MEK2 Rabbit pAb (A18117) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of various lysates using MEK1/MEK2 Rabbit pAb (A18117) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	MEK1/MEK2 Rabbit pAb
Catalog No.	A18117
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein MEK1 and MEK2 are two members of the dual specificity protein kinase family, which act as mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MAP2K1 (NP_002746.1).
Sequence	SRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
Gene ID
Swiss Prot
Synonyms	MEK1/MEK2
Calculated MW	40kDa/43kDa/44kDa
Observed MW	44kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	mouse brain, mouse spleen, PC-12
Cellular location	cytosol, early endosome, endoplasmic reticulum, focal adhesion, Golgi apparatus, late endosome, microtubule organizing center, mitochondrion, nucleus, plasma membrane.
Customer validation	WB(Mus musculus, Homo sapiens)