제품 > 항체 > 단일클론항체(mAb)

MEK1 Rabbit mAb (A19565)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MEK1 Rabbit mAb (A19565) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

ABclonal:Immunofluorescence - MEK1 Rabbit mAb (A19565)

Immunofluorescence analysis of C6 cells using MEK1 Rabbit mAb (A19565). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - MEK1 Rabbit mAb (A19565)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg MEK1 antibody (A19565). Western blot was performed from the immunoprecipitate using MEK1 (A19565) at a dilution of 1:1000.

Overview

Product name	MEK1 Rabbit mAb
Catalog No.	A19565
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0044

Background

The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK1 (Q02750).
Sequence	MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH
Gene ID
Swiss Prot
Synonyms	MEL; CFC3; MEK1; MKK1; MAPKK1; PRKMK1
Calculated MW	43kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, HepG2, A-431, Mouse brain, Mouse lung, Rat lung
Cellular location	Cytoplasm, Membrane, Nucleus, Peripheral membrane protein, centrosome, cytoskeleton, microtubule organizing center, spindle pole body
Customer validation	WB(Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

MEK1 Rabbit mAb images

Western blot - MEK1 Rabbit mAb (A19565)

Immunofluorescence - MEK1 Rabbit mAb (A19565)

Immunofluorescence analysis of C6 cells using MEK1 Rabbit mAb (A19565). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation - MEK1 Rabbit mAb (A19565)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg MEK1 antibody (A19565). Western blot was performed from the immunoprecipitate using MEK1 (A19565) at a dilution of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.