제품 > 항체 > 단일클론항체(mAb)

MEK1 Rabbit mAb (A22436)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using MEK1 Rabbit mAb (A22436) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - MEK1 Rabbit mAb (A22436)

Immunohistochemistry analysis of paraffin-embedded rat liver using MEK1 Rabbit mAb (A22436) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - MEK1 Rabbit mAb (A22436)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg MEK1 antibody (A22436). Western blot was performed from the immunoprecipitate using MEK1 antibody (A22436) at a dilution of 1:1000.

Overview

Product name	MEK1 Rabbit mAb
Catalog No.	A22436
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2616

Background

The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human MEK1 (Q02750).
Sequence	SLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMG
Gene ID
Swiss Prot
Synonyms	MEL; CFC3; MEK1; MKK1; MAPKK1; PRKMK1
Calculated MW	43kDa
Observed MW	46kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, Mouse brain, Rat brain
Cellular location	Cytoplasm, Membrane, Nucleus, Peripheral membrane protein, centrosome, cytoskeleton, microtubule organizing center, spindle pole body