Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | MMP13 Rabbit mAb |
---|---|
Catalog No. | A11148 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0528 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MMP13 (P45452). |
---|---|
Sequence | RGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQF |
Gene ID | |
Swiss Prot | |
Synonyms | CLG3; MDST; MANDP1; MMP-13; MMP13 |
Calculated MW | 54kDa |
Observed MW | 60kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | A-549, MCF7 |
Cellular location | Secreted, extracellular matrix, extracellular space. |
Customer validation | WB(Gallus gallus, Homo sapiens, Mus musculus, Rattus norvegicus) ELISA(Mus musculus) IHC(Mus musculus, Rattus norvegicus, Gallus gallus) IF(Homo sapiens, Gallus gallus) IF(Mus musculus) IHC(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11148? Please let us know so that we can cite the reference in this datasheet.