제품 > 항체 > 다중클론항체(pAb)

MYL9 Rabbit pAb (A3039)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MYL9 Rabbit pAb (A3039) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - MYL9 Rabbit pAb (A3039)

Immunofluorescence analysis of Rat intestine using MYL9 Rabbit pAb (A3039) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Human colon carcinoma using MYL9 Rabbit pAb (A3039) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Mouse intestine using MYL9 Rabbit pAb (A3039) at dilution of 1:100. Blue: DAPI for nuclear staining.

Review

Overview

Product name	MYL9 Rabbit pAb
Catalog No.	A3039
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (NP_006088.2).
Sequence	MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPE
Gene ID
Swiss Prot
Synonyms	LC20; MLC2; MRLC1; MYRL2; MLC-2C; MMIHS4; MYL9
Calculated MW	20kDa
Observed MW	18kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	C2C12, C6, Mouse lung, Rat heart
Cellular location	cell cortex, cytoplasm, cytosol, myofibril, Z disc.
Customer validation	(HepG2) IF(Homo sapiens) WB(Rattus norvegicus)