제품 > 항체 > 다중클론항체(pAb)

PD-1/CD279 Rabbit pAb (A11973)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PD-1/CD279 Rabbit pAb (A11973) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of various lysates using PD-1/CD279 Rabbit pAb (A11973) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - PD-1/CD279 Rabbit pAb (A11973)

Immunofluorescence analysis of paraffin-embedded human tonsil using PD-1/CD279 Rabbit pAb (A11973) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PD-1/CD279 Rabbit pAb
Catalog No.	A11973
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 205-259 of human PD-1/CD279 (NP_005009.2).
Sequence	TGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGT
Gene ID
Swiss Prot
Synonyms	PD1; PD-1; CD279; SLEB2; hPD-1; hPD-l; hSLE1; PD-1/CD279
Calculated MW	32kDa
Observed MW	50kDa/35kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, K-562, HL-60, MOLT-4, Mouse spleen, Rat thymus
Cellular location	Membrane, Single-pass type I membrane protein.
Customer validation	IHC(Homo sapiens) IF(Homo sapiens) WB(Rattus norvegicus, Mus musculus) RNA-Seq(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PD-1/CD279 Rabbit pAb images

Western blot - PD-1/CD279 Rabbit pAb (A11973)

Western blot analysis of various lysates using PD-1/CD279 Rabbit pAb (A11973) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunofluorescence - PD-1/CD279 Rabbit pAb (A11973)

* For research use only. Not for therapeutic or diagnostic purposes.