Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PERK Rabbit mAb |
---|---|
Catalog No. | A21255 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC52369 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 580-720 of human PERK (NP_004827.4). |
---|---|
Sequence | IKNSGYISRYLTDFEPIQCLGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLEAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSR |
Gene ID | |
Swiss Prot | |
Synonyms | PEK; WRS; PERK |
Calculated MW | 125kDa |
Observed MW | 140kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, K-562, NIH/3T3, PC-12 |
Cellular location | Endoplasmic reticulum membrane, Single-pass type I membrane protein. |
Customer validation | WB(Homo sapiens, Gallus gallus) qPCR(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21255? Please let us know so that we can cite the reference in this datasheet.