Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PKM2-specific Rabbit pAb |
---|---|
Catalog No. | A18799 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 380-480 of human PKM2-specific (NP_002645.3). |
---|---|
Sequence | LIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE |
Gene ID | |
Swiss Prot | |
Synonyms | PK3; TCB; p58; OIP3; PKM2; CTHBP; THBP1; HEL-S-30; PKM2-specific |
Calculated MW | 58kDa |
Observed MW | 58kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, 293T, A-549, NIH/3T3, C6, Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB(Homo sapiens) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18799? Please let us know so that we can cite the reference in this datasheet.