제품 > 항체 > 단일클론항체(mAb)

ABflo® 450 Rabbit anti-Human/Mouse BCL6 mAb (A26764)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HAP1 cells (Low Expression, left) and Daudi cells (right) were intracellularly-stained with ABflo® 450 Rabbit anti-Human/Mouse BCL6 mAb (A26764, 5 μl/Test, orange line) or ABflo® 450 Rabbit IgG isotype control (5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Daudi cells were intracellularly-stained with ABflo® 450 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 450 Rabbit anti-Human/Mouse BCL6 mAb (A26764, 5 μl/Test, right).

Overview

Product name	ABflo® 450 Rabbit anti-Human/Mouse BCL6 mAb
Catalog No.	A26764
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57886-ABflo450

Background

The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human/mouse BCL6 (NP_001124317.1).
Sequence	ARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS
Gene ID
Swiss Prot
Synonyms	BCL5; LAZ3; BCL6A; ZNF51; ZBTB27
Calculated MW	79kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Nucleus, Golgi apparatus, nucleolus, nucleoplasm, nucleus, paraspeckles.