제품 > 항체 > 단일클론항체(mAb)

BCL6 Rabbit mAb (A22610)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunohistochemistry analysis of paraffin-embedded Human tonsil using BCL6 Rabbit mAb (A22610) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Flow CytoMetry - BCL6 Rabbit mAb (A22610)

Flow cytometry:1X10^6 HAP1 cells (Low Expression, Left) and Daudi cells (Right) were intracellularly-stained with BCL6 Rabbit mAb(A22610, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb (1:200 dilution) staining.Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 A20 cells were intracellularly-stained with BCL6 Rabbit mAb(A22610, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb (1:200 dilution) staining.Non-fluorescently stained A20 cells were used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or BCL6 Rabbit mAb(A22610, 2 μg/mL, right).

Flow cytometry:1X10^6 A20 cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or BCL6 Rabbit mAb(A22610, 2 μg/mL, right).

Overview

Product name	BCL6 Rabbit mAb
Catalog No.	A22610
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57886

Background

The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1).
Sequence	PKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
Gene ID
Swiss Prot
Synonyms	BCL5; LAZ3; BCL6A; ZNF51; ZBTB27; BCL6
Calculated MW	79kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:100 - 1:500 FC (intra) 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BCL6 Rabbit mAb images

Immunohistochemistry - BCL6 Rabbit mAb (A22610)

Flow CytoMetry - BCL6 Rabbit mAb (A22610)

Flow cytometry:1X10^6 Daudi cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or BCL6 Rabbit mAb(A22610, 2 μg/mL, right).

Flow CytoMetry - BCL6 Rabbit mAb (A22610)

Flow cytometry:1X10^6 A20 cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or BCL6 Rabbit mAb(A22610, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.