Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | ABflo® 647 Rabbit anti-Human/Mouse BCL6 mAb |
---|---|
Catalog No. | A23848 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC57886-ABflo647 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1). |
---|---|
Sequence | ARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS |
Gene ID | |
Swiss Prot | |
Synonyms | BCL6; BCL5; BCL6A; LAZ3; ZBTB27; ZNF51; B-cell CLL/lymphoma 6 |
Calculated MW | 72kDa/78kDa |
Observed MW |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | |
Positive samples | |
Cellular location | Nucleus. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.