Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | ABflo® 610 Rabbit anti-Human/Mouse BCL6 mAb |
---|---|
Catalog No. | A26765 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC57886-ABflo610 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human/mouse BCL6 (NP_001124317.1). |
---|---|
Sequence | ARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS |
Gene ID | |
Swiss Prot | |
Synonyms | BCL5; LAZ3; BCL6A; ZNF51; ZBTB27 |
Calculated MW | 79kDa |
Observed MW |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3. |
Key application | |
Positive samples | |
Cellular location | Nucleus, Golgi apparatus, nucleolus, nucleoplasm, nucleus, paraspeckles. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.