제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human TROP-2 mAb (A24361)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 U-118MG cells (negative control, left) and MCF7 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human TROP-2 mAb(A24361, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgM isotype control (5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 MCF7 cells were surface-stained with ABflo® 647 Rabbit IgM isotype control (5 μl/Test, left) or ABflo® 647 Rabbit anti-Human TROP-2 mAb(A24361, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human TROP-2 mAb
Catalog No.	A24361
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgM
CloneNo.	ARC51505-IgM-01-ABf647

Background

This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human TROP-2 (NP_002344.2).
Sequence	HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Gene ID
Swiss Prot
Synonyms	TACSTD2; EGP-1; EGP1; GA733-1; GA7331; GP50; M1S1; TROP2; tumor-associated calcium signal transducer 2
Calculated MW	35kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 647 Rabbit anti-Human TROP-2 mAb images

Flow CytoMetry - ABflo® 647 Rabbit anti-Human TROP-2 mAb (A24361)

Flow cytometry:1X10^6 MCF7 cells were surface-stained with ABflo® 647 Rabbit IgM isotype control (5 μl/Test, left) or ABflo® 647 Rabbit anti-Human TROP-2 mAb(A24361, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.