제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human TROP-2 mAb (A26262)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 U-118 MG cells (negative control, left) and MCF7 cells (right) were surface-stained with PE Rabbit anti-Human TROP-2 mAb (A26262, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 MCF7 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human TROP-2 mAb (A26262, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human TROP-2 mAb
Catalog No.	A26262
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51505-PE

Background

This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human TROP-2 (NP_002344.2).
Sequence	HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Gene ID
Swiss Prot
Synonyms	EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Calculated MW	36kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human TROP-2 mAb images

Flow CytoMetry - PE Rabbit anti-Human TROP-2 mAb (A26262)

Flow cytometry: 1X10^6 MCF7 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human TROP-2 mAb (A26262, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.