제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse CD69 mAb (A24939)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 NIH/3T3 cells (negative control, left) and CTLL-2 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Mouse CD69 mAb (A24939, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 CTLL-2 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD69 mAb (A24939, 5 μl/Test, right).

Flow cytometry: 1X10^6 BALB/c mouse splenocytes cells (negative control, left) and BALB/c mouse splenocytes cells (treated with 10 ng/mL PMA for 5 hours, right) were surface-stained with ABflo® 647 Rabbit anti-Mouse CD69 mAb (A24939, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 BALB/c mouse splenocytes cells (treated with 10 ng/mL PMA for 5 hours) were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD69 mAb (A24939, 5 μl/Test, right).

Review

Overview

Product name	ABflo® 647 Rabbit anti-Mouse CD69 mAb
Catalog No.	A24939
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64627-ABflo647

Background

Predicted to enable calcium ion binding activity and identical protein binding activity. Located in external side of plasma membrane. Orthologous to human CD69 (CD69 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to aminoacids 64-199 of mouse CD69(NP_001028294.1).
Sequence	GKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR
Gene ID
Swiss Prot
Synonyms	AIM; VEA; 5830438K24Rik
Calculated MW	22kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane , Single-pass type II membrane protein
Customer validation	(Mouse lung tissue)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 647 Rabbit anti-Mouse CD69 mAb images

Flow CytoMetry - ABflo® 647 Rabbit anti-Mouse CD69 mAb (A24939)

Flow cytometry: 1X10^6 CTLL-2 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD69 mAb (A24939, 5 μl/Test, right).

Flow CytoMetry - ABflo® 647 Rabbit anti-Mouse CD69 mAb (A24939)

* For research use only. Not for therapeutic or diagnostic purposes.