제품 > 항체 > 단일클론항체(mAb)

CD69 Rabbit mAb (A24941)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 NIH/3T3 cells (negative control, left) and CTLL-2 cells (right) were surface-stained with CD69 Rabbit mAb (A24941, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 CTLL-2 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD69 Rabbit mAb (A24941, 2 μg/mL, right).

Overview

Product name	CD69 Rabbit mAb
Catalog No.	A24941
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64627

Background

Predicted to enable calcium ion binding activity and identical protein binding activity. Located in external side of plasma membrane. Orthologous to human CD69 (CD69 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to aminoacids 64-199 of mouse CD69(NP_001028294.1).
Sequence	GKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR
Gene ID
Swiss Prot
Synonyms	AIM; VEA; 5830438K24Rik; CD69
Calculated MW	22kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane , Single-pass type II membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD69 Rabbit mAb images

Flow CytoMetry - CD69 Rabbit mAb (A24941)

Flow cytometry: 1X10^6 CTLL-2 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD69 Rabbit mAb (A24941, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.