제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse CD69 mAb (A26445)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes (treated with PMA) were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD69 mAb (A26445, 5 μl/Test, right).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD69 mAb (A26445, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Mouse CD69 mAb
Catalog No.	A26445
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64627-PE

Background

Predicted to enable calcium ion binding activity and identical protein binding activity. Located in external side of plasma membrane. Orthologous to human CD69 (CD69 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 64-199 of mouse CD69 (NP_001028294.1).
Sequence	GKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR
Gene ID
Swiss Prot
Synonyms	AIM; VEA; 5830438K24Rik
Calculated MW	22kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type II membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Mouse CD69 mAb images

Flow CytoMetry - PE Rabbit anti-Mouse CD69 mAb (A26445)

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD69 mAb (A26445, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.