제품 > 항체 > 단일클론항체(mAb)

CD80 Rabbit mAb (A19025)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CD80 Rabbit mAb (A19025) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	CD80 Rabbit mAb
Catalog No.	A19025
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0384

Background

The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 189-288 of human CD80 (P33681).
Sequence	VSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV
Gene ID
Swiss Prot
Synonyms	B7; BB1; B7-1; B7.1; LAB7; CD28LG; CD28LG1; CD80
Calculated MW	33kDa
Observed MW	50-75kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Raji, K-562
Cellular location	Membrane, Single-pass type I membrane protein
Customer validation	WB(Homo sapiens)