Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Catalase Rabbit mAb |
---|---|
Catalog No. | A11220 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0550 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Catalase (P04040). |
---|---|
Sequence | MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVF |
Gene ID | |
Swiss Prot | |
Synonyms | CAT; catalase; Catalase |
Calculated MW | 60kDa |
Observed MW | 60kDa/ |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse lung, Mouse liver, Mouse kidney, Rat lung, Rat liver, Rat kidney, Hep G2 |
Cellular location | Peroxisome. |
Customer validation | WB(Homo sapiens, Mus musculus, Bos taurus) IHC(Homo sapiens) Co-IP(Homo sapiens) IHC(Homo sapiens, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11220? Please let us know so that we can cite the reference in this datasheet.