Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Cyclin B1 Rabbit mAb |
---|---|
Catalog No. | A22435 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2614 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 334-433 of human Cyclin B1 (P14635). |
---|---|
Sequence | YDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV |
Gene ID | |
Swiss Prot | |
Synonyms | CCNB; Cyclin B1 |
Calculated MW | 48kDa |
Observed MW | 55kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | Jurkat |
Cellular location | Cytoplasm, Nucleus, Centrosome, Cytoskeleton, Microtubule Organizing center. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22435? Please let us know so that we can cite the reference in this datasheet.