제품 > 항체 > 단일클론항체(mAb)

Cyclin B1 Rabbit mAb (A22435)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from Jurkat cells, using Cyclin B1 Rabbit mAb (A22435) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Cyclin B1 Rabbit mAb (A22435)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Cyclin B1 Rabbit mAb (A22435) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - Cyclin B1 Rabbit mAb (A22435)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg Cyclin B1 antibody (A22435). Western blot was performed from the immunoprecipitate using Cyclin B1 antibody (A22435) at a dilution of 1:1000.

Overview

Product name	Cyclin B1 Rabbit mAb
Catalog No.	A22435
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2614

Background

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the cell cycle.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 334-433 of human Cyclin B1 (P14635).
Sequence	YDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Gene ID
Swiss Prot
Synonyms	CCNB; Cyclin B1
Calculated MW	48kDa
Observed MW	55kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:200 - 1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	Jurkat
Cellular location	Cytoplasm, Nucleus, Centrosome, Cytoskeleton, Microtubule Organizing center.
Customer validation	WB(Homo sapiens)