Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Caspase-1 Rabbit pAb |
---|---|
Catalog No. | A16792 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-297 of human Caspase-1 (NP_150634.1). |
---|---|
Sequence | NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD |
Gene ID | |
Swiss Prot | |
Synonyms | ICE; P45; IL1BC |
Calculated MW | 45kDa |
Observed MW | 48kDa/20-25kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | EL4, Mouse spleen, Rat spleen |
Cellular location | Cytoplasm. |
Customer validation | WB(Mus musculus, Homo sapiens, Gallus gallus, Rattus norvegicus, Homo sapiens, Rattus norvegicus) IF(Mus musculus) IHC(Mus musculus) WB (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16792? Please let us know so that we can cite the reference in this datasheet.