Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Collagen I/COL1A1 Rabbit mAb |
---|---|
Catalog No. | A24112 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC53617 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1150-1250 of human Collagen I/COL1A1 (NP_000079.2). |
---|---|
Sequence | PGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEG |
Gene ID | |
Swiss Prot | |
Synonyms | OI1; OI2; OI3; OI4; EDSC; CAFYD; EDSARTH1; Collagen I/COL1A1 |
Calculated MW | 139kDa |
Observed MW | 130kDa,220kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | U118-MG, U251-MG |
Cellular location | Secreted, extracellular matrix, extracellular space. |
Customer validation | WB(Mus musculus, Cavia porcellus) IHC(Oryctolagus cuniculus) RT-PCR(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A24112? Please let us know so that we can cite the reference in this datasheet.