Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of various lysates using Pro-Collagen I/COL1A1 Rabbit mAb (A26946) at 1:13000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HT-29
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Pro-Collagen I/COL1A1 Rabbit mAb (A26946) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Pro-Collagen I/COL1A1 Rabbit mAb (A26946) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Pro-Collagen I/COL1A1 Rabbit mAb (A26946) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Pro-Collagen I/COL1A1 Rabbit mAb (A26946) at a dilution of 1:1300 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Human colon tissue using Pro-Collagen I/COL1A1 Rabbit mAb (A26946, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Immunoprecipitation of Pro-Collagen I/COL1A1 from 300 µg extracts of U-138MG cells was performed using 0.5 µg of Pro-Collagen I/COL1A1 Rabbit mAb (A26946). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using Pro-Collagen I/COL1A1 Rabbit mAb (A26946) at a dilution of 1:13000.
| Product name | Pro-Collagen I/COL1A1 Rabbit mAb |
|---|---|
| Catalog No. | A26946 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC70097 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-161 of human Collagen I/COL1A1 (NP_000079.2). |
|---|---|
| Sequence | GQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | OI1; OI2; OI3; OI4; EDSC; CAFYD; EDSARTH1 |
| Calculated MW | 139kDa |
| Observed MW | 220kDa |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | U-118 MG, U-138 MG |
| Cellular location | Secreted, extracellular matrix, extracellular space. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
