Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Human Pro-Collagen I alpha Rabbit pAb |
---|---|
Catalog No. | A24863 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-161 of human Collagen I/COL1A1 (NP_000079.2). |
---|---|
Sequence | GQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAP |
Gene ID | |
Swiss Prot | |
Synonyms | COL1A1; EDSC; OI1; OI2; OI3; OI4; collagen alpha-1(I) chain; Human Pro-Collagen I alpha |
Calculated MW | 138kDa |
Observed MW | 220kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | U-138 MG |
Cellular location | Secreted, extracellular matrix, extracellular space |
Customer validation | IHC(Mus musculus) WB(Mus musculus, Homo sapiens) WB(Homo sapiens, Rattus norvegicus) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A24863? Please let us know so that we can cite the reference in this datasheet.