제품 > 항체 > 다중클론항체(pAb)

Human Pro-Collagen I alpha Rabbit pAb (A24863)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from U-138 MG cells using Human Pro-Collagen I alpha Rabbit pAb(A24863) at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Enhanced Kit (RM00021).
Exposuretime:30s.

ABclonal:Immunohistochemistry - Human Pro-Collagen I alpha Rabbit pAb (A24863)

Immunohistochemistry analysis of Human Pro-Collagen I alpha in paraffin-embedded human colon tissue using Human Pro-Collagen I alpha Rabbit pAb (A24863) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Human Pro-Collagen I alpha Rabbit pAb (A24863)

Immunofluorescence analysis of paraffin-embedded human colon using Human Pro-Collagen I alpha Rabbit pAb (A24863) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	Human Pro-Collagen I alpha Rabbit pAb
Catalog No.	A24863
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 26-161 of human Collagen I/COL1A1 (NP_000079.2).
Sequence	GQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAP
Gene ID
Swiss Prot
Synonyms	COL1A1; EDSC; OI1; OI2; OI3; OI4; collagen alpha-1(I) chain; Human Pro-Collagen I alpha
Calculated MW	138kDa
Observed MW	220kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	U-138 MG
Cellular location	Secreted, extracellular matrix, extracellular space
Customer validation	IHC(Mus musculus) WB(Mus musculus, Homo sapiens) WB(Homo sapiens) IF(Homo sapiens)