Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Cytochrome C Rabbit mAb (A4912) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Cytochrome C Rabbit mAb (A4912) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Cytochrome C Rabbit mAb (A4912) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Cytochrome C Rabbit mAb (A4912) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Cytochrome C Rabbit mAb (A4912) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Cytochrome C Rabbit mAb (A4912) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Cytochrome C Rabbit mAb (A4912) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Cytochrome C Rabbit mAb (A4912) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Cytochrome C Rabbit mAb (A4912) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Cytochrome C Rabbit mAb (A4912) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
| Product name | Cytochrome C Rabbit mAb |
|---|---|
| Catalog No. | A4912 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1153 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-105 of human Cytochrome C (P99999). |
|---|---|
| Sequence | MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CYC; HCS; THC4; C |
| Calculated MW | 12kDa |
| Observed MW | 14kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HeLa, Mouse brain, Mouse kidney, Mouse heart, Rat brain, Rat kidney |
| Cellular location | Mitochondrion intermembrane space. |
| Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, Homo sapiens, Other, Lampetra japonica) IF(Homo sapiens, Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4912? Please let us know so that we can cite the reference in this datasheet.
