Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ESRα Rabbit mAb |
---|---|
Catalog No. | A12976 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0199 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Estrogen Receptor alpha (ESRα) (P03372). |
---|---|
Sequence | AVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFY |
Gene ID | |
Swiss Prot | |
Synonyms | ER; ESR; Era; ESRA; ESTRR; NR3A1; ESRα |
Calculated MW | 66kDa |
Observed MW | 66kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | MCF7 |
Cellular location | Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic side, Golgi apparatus, Nucleus, Peripheral membrane protein, Single-pass type I membrane protein. |
Customer validation | WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12976? Please let us know so that we can cite the reference in this datasheet.