제품 > 항체 > 단일클론항체(mAb)

HSL/LIPE Rabbit mAb (A24689)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Mouse fat, using HSL/LIPE Rabbit mAb (A24689) at 1:8000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - HSL/LIPE Rabbit mAb (A24689)

Confocal imaging of Daudi cells using HSL/LIPE Rabbit mAb (A24689, at dilution of 1:200) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	HSL/LIPE Rabbit mAb
Catalog No.	A24689
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64016

Background

The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 901-1000 of human HSL/LIPE (NP_005348.2).
Sequence	LSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDS
Gene ID
Swiss Prot
Synonyms	HSL; LHS; REH; AOMS4; FPLD6; HSL/LIPE
Calculated MW	117kDa
Observed MW	83kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:9000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse fat
Cellular location	Cell membrane, Cytoplasm, Membrane, caveola, cytosol.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HSL/LIPE Rabbit mAb images

Western blot - HSL/LIPE Rabbit mAb (A24689)

Immunofluorescence - HSL/LIPE Rabbit mAb (A24689)

Confocal imaging of Daudi cells using HSL/LIPE Rabbit mAb (A24689, at dilution of 1:200) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.

* For research use only. Not for therapeutic or diagnostic purposes.