Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Western blot analysis of various lysates using Histone H2AX Rabbit pAb (A11463) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Histone H2AX Rabbit pAb (A11463) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human placenta using Histone H2AX Rabbit pAb (A11463) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Histone H2AX Rabbit pAb (A11463) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat liver using Histone H2AX Rabbit pAb (A11463) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Confocal immunofluorescence analysis of HeLa cells using Histone H2AX Rabbit pAb (A11463) at dilution of 1:400. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of U-2 OS cells using Histone H2AX Rabbit pAb (A11463) at dilution of 1:400. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using Histone H2AX Rabbit pAb (A11463) at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Histone H2AX Rabbit pAb |
|---|---|
| Catalog No. | A11463 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-143 of human Histone H2AX (NP_002096.1). |
|---|---|
| Sequence | VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H2A.X; H2A/X; H2AFX; Histone H2AX |
| Calculated MW | 15kDa |
| Observed MW | 15kDa |
| Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | HeLa, MCF-7, NIH/3T3, Raji, Mouse testis, Mouse thymus, Rat thymus |
| Cellular location | Chromosome, Nucleus. |
| Customer validation | WB(Mus musculus, Homo sapiens) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11463? Please let us know so that we can cite the reference in this datasheet.
