제품 > 항체 > 단일클론항체(mAb)

IRS1 Rabbit mAb (A19074)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HepG2 cells, using IRS1 Rabbit mAb (A19074) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	IRS1 Rabbit mAb
Catalog No.	A19074
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0486

Background

This gene encodes a protein which is phosphorylated by insulin receptor tyrosine kinase. Mutations in this gene are associated with type II diabetes and susceptibility to insulin resistance.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human IRS1 (P35568).
Sequence	SSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ
Gene ID
Swiss Prot
Synonyms	HIRS-1; IRS1
Calculated MW	132kDa
Observed MW	170kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2
Cellular location	Caveola, Cytoplasm, Cytosol, Nucleoplasm, Nucleus, Plasma membrane.
Customer validation	WB(Mus musculus, Homo sapiens) IHC(Mus musculus)