Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | [KO Validated] BRD4 Rabbit pAb |
---|---|
Catalog No. | A20019 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 600-722 of human BRD4 (NP_055114.1). |
---|---|
Sequence | ESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETGPA |
Gene ID | |
Swiss Prot | |
Synonyms | CAP; MCAP; HUNK1; HUNKI; FSHRG4; D4 |
Calculated MW | 80kDa/88kDa/152kDa |
Observed MW | 200kDa/140kDa/120kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, HeLa-BRD4-FL, HeLa-BRD4-S(a), HeLa-BRD4-S(b) |
Cellular location | Chromosome, Nucleus. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20019? Please let us know so that we can cite the reference in this datasheet.