Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] Bax Rabbit mAb |
---|---|
Catalog No. | A18642 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC5006-06 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 10-70 of human Bax (NP_620116.1). |
---|---|
Sequence | GGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL |
Gene ID | |
Swiss Prot | |
Synonyms | BCL2L4; ax |
Calculated MW | 21kDa |
Observed MW | 21kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | 293T, HT-1080 |
Cellular location | Cytoplasm, Mitochondrion membrane, Single-pass membrane protein. |
Customer validation | WB(Homo sapiens, Mus musculus) IHC(Oreochromis niloticus, Rattus norvegicus) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18642? Please let us know so that we can cite the reference in this datasheet.