Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] Src Rabbit mAb |
---|---|
Catalog No. | A19119 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0378 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Src (P12931). |
---|---|
Sequence | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE |
Gene ID | |
Swiss Prot | |
Synonyms | ASV; SRC1; THC6; c-SRC; p60-Src; rc |
Calculated MW | 60kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, Jurkat, Mouse brain, Mouse lung, Rat brain |
Cellular location | Cell membrane, Cytoplasm, Mitochondrion inner membrane, Nucleus, cytoskeleton. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, Other) IF(Homo sapiens) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19119? Please let us know so that we can cite the reference in this datasheet.