제품 > 항체 > 다중클론항체(pAb)

Non-phospho-YAP1-S127 Rabbit pAb (A20250)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from A-549 cells, using Non-phospho-YAP1-S127 Rabbit pAb (A20250) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Non-phospho-YAP1-S127 Rabbit pAb (A20250)

Immunohistochemistry analysis of paraffin-embedded Mouse testis using Non-phospho-YAP1-S127 Rabbit pAb (A20250) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	Non-phospho-YAP1-S127 Rabbit pAb
Catalog No.	A20250
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human YAP1 (NP_001123617.1).
Sequence	AGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSG
Gene ID
Swiss Prot
Synonyms	YAP; YKI; COB1; YAP2; YAP-1; YAP65; Non-phospho-YAP1-S127
Calculated MW	54kDa
Observed MW	68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A-549
Cellular location	Cytoplasm, Nucleus.