Reviews (8)Publications (43) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of lysates from wild type (WT) and YAP1 knockout (KO) HeLa cells using YAP1 Rabbit pAb (A1002) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human colon (low expression samples) using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Confocal immunofluorescence analysis of U2OS cells using YAP1 Rabbit pAb (A1002) at dilution of 1:200. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using YAP1 Rabbit pAb (A1002) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using YAP1 Rabbit pAb (A1002) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg YAP1 antibody (A1002). Western blot was performed from the immunoprecipitate using YAP1 antibody (A1002) at a dilution of 1:1000.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg YAP1 antibody (A1002). Western blot was performed from the immunoprecipitate using YAP1 (A1002) at a dilution of 1:1000.
| Product name | YAP1 Rabbit pAb |
|---|---|
| Catalog No. | A1002 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
|---|---|
| Sequence | PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | YAP; YKI; COB1; YAP2; YAP-1; YAP65; YAP1 |
| Calculated MW | 54kDa |
| Observed MW | 70kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | HeLa |
| Cellular location | Cytoplasm, Nucleus. |
| Customer validation | (THP1, 293T, Peritoneal macrophage, HEK293T,MCF7, MG63, Human breast cancer, DLD-1) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Sus scrofa, Oryctolagus cuniculus) IF(Homo sapiens, Mus musculus, Danio rerio) IHC(Homo sapiens, Mus musculus) IF(Homo sapiens, Sus scrofa, Mus musculus) IP(Homo sapiens) IHC(Homo sapiens, Mus musculus, Rattus norvegicus) ChIP(Homo sapiens) Co-IP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A1002? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1716539287)
![[KO Validated] YAP1 Rabbit mAb](https://img.abclonal.com/abclonal-manage/Catalog/A19134/A19134_1.jpg?t=1728970875)
_WB_01.jpg?t=1721361790)
![[KO Validated] YAP1 Rabbit mAb](https://img.abclonal.com/abclonal-manage/Catalog/A21216/A21216_2.jpg?t=1729072114)
![[KO Validated] YAP1 Rabbit pAb](https://img.abclonal.com/abclonal-manage/Catalog/A11264/A11264_1.jpg?t=1733907554)
_WB_01.jpg?t=1709183517)
