Reviews (8)Publications (45) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | YAP1 Rabbit pAb |
---|---|
Catalog No. | A1002 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
---|---|
Sequence | PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL |
Gene ID | |
Swiss Prot | |
Synonyms | YAP; YKI; COB1; YAP2; YAP-1; YAP65; YAP1 |
Calculated MW | 54kDa |
Observed MW | 70kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (THP1, 293T, Peritoneal macrophage, HEK293T,MCF7, MG63, Human breast cancer, DLD-1) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Sus scrofa, Oryctolagus cuniculus) IF(Homo sapiens, Mus musculus, Danio rerio) IHC(Homo sapiens, Mus musculus) IF(Homo sapiens, Sus scrofa, Mus musculus) IP(Homo sapiens) IHC(Homo sapiens, Mus musculus, Rattus norvegicus) ChIP(Homo sapiens) Co-IP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A1002? Please let us know so that we can cite the reference in this datasheet.