Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Osteocalcin (BGLAP) Rabbit mAb |
---|---|
Catalog No. | A20800 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51116 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BGLAP. (NP_954642.1). |
---|---|
Sequence | MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRR |
Gene ID | |
Swiss Prot | |
Synonyms | OC; BGP; OCN; Osteocalcin (BGLAP) |
Calculated MW | 11kDa |
Observed MW | 11kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | A-549, U-87MG, Mouse fat, Rat lung, Mouse lung, Rat brain, Rat spleen |
Cellular location | Secreted. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens, Felis catus, Other) IF(Rattus norvegicus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20800? Please let us know so that we can cite the reference in this datasheet.