Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PP2A alpha/beta Rabbit mAb |
---|---|
Catalog No. | A6175 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1889 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-309 of human PP2A alpha + beta (P62714). |
---|---|
Sequence | WSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
Gene ID | |
Swiss Prot | |
Synonyms | PP2Abeta; PP2CB; PP2A alpha + beta |
Calculated MW | 36kDa |
Observed MW | 36kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, 293T, NIH/3T3, Jurkat, C6, Mouse testis, Mouse brain, Rat lung, Rat testis |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | WB(Mus musculus, Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A6175? Please let us know so that we can cite the reference in this datasheet.