Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Tau Rabbit mAb |
---|---|
Catalog No. | A23490 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC58125 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAPT (NM_005910.6) |
---|---|
Sequence | MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG |
Gene ID | |
Swiss Prot | |
Synonyms | TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; tau-40; FTDP-17; PPP1R103; Tau-PHF6; Tau |
Calculated MW | 79kDa |
Observed MW | 50-80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | SH-SY5Y, U-251MG, Mouse brain, Rat brain |
Cellular location | Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, axon, Cytoskeleton, Cytosol. |
Customer validation | WB(Drosophila melanogaster,Felis catus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23490? Please let us know so that we can cite the reference in this datasheet.