제품 > 항체 > 단일클론항체(mAb)

Tau Rabbit mAb (A23490)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Tau Rabbit mAb (A23490) at 1:2000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - Tau Rabbit mAb (A23490)

Confocal imaging of human brain using Tau Rabbit mAb (A23490, dilution 1:400) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Confocal imaging of mouse brain using Tau Rabbit mAb (A23490, dilution 1:400) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Overview

Product name	Tau Rabbit mAb
Catalog No.	A23490
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC58125

Background

This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAPT (NM_005910.6)
Sequence	MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG
Gene ID
Swiss Prot
Synonyms	TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; tau-40; FTDP-17; PPP1R103; Tau-PHF6; Tau
Calculated MW	79kDa
Observed MW	50-80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:400 - 1:1600 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	SH-SY5Y, U-251MG, Mouse brain, Rat brain
Cellular location	Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, axon, Cytoskeleton, Cytosol.
Customer validation	WB(Drosophila melanogaster,Felis catus)