제품 > 항체 > 단일클론항체(mAb)

p90Rsk/RSK1/RPS6KA1 Rabbit mAb (A4695)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using p90Rsk/RSK1/RPS6KA1 Rabbit mAb (A4695) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	p90Rsk/RSK1/RPS6KA1 Rabbit mAb
Catalog No.	A4695
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1096

Background

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p90Rsk/RSK1/RPS6KA1 (Q15418).
Sequence	MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKAT
Gene ID
Swiss Prot
Synonyms	RSK; HU-1; RSK1; p90Rsk; MAPKAPK1; MAPKAPK1A
Calculated MW	83kDa
Observed MW	83kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, K-562, Mouse lung
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Homo sapiens, Mus musculus, Sus scrofa)