제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human IgG (Fc) mAb (A22505)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were intracellularly-stained with ABflo® 647 Rabbit anti-Human IgG (Fc) mAb(A22505, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human IgG (Fc) mAb(A22505, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test) or ABflo® 647 Rabbit anti-Human IgG (Fc) mAb(A22505, 5 μl/Test).The cells were simultaneously stained with ABflo® 488 Rabbit anti-Human/Monkey CD19 mAb(A23008, 5 μl/Test).

Overview

Product name	ABflo® 647 Rabbit anti-Human IgG (Fc) mAb
Catalog No.	A22505
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53383-ABf647

Background

Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to act upstream of or within several processes, including immunoglobulin mediated immune response; positive regulation of hypersensitivity; and positive regulation of phagocytosis. Located in extracellular space.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-330 of human IgG1 (Fc) (P01857).
Sequence	PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Gene ID
Swiss Prot
Synonyms
Calculated MW	36kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Cell membrane, Single-pass membrane protein, Secreted