제품 > 항체 > 다중클론항체(pAb)

CD25 Rabbit pAb (A2984)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CD25 Rabbit pAb (A2984) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - CD25 Rabbit pAb (A2984)

Immunohistochemistry analysis of paraffin-embedded Human tonsil using CD25 Rabbit pAb (A2984) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen using CD25 Rabbit pAb (A2984) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human gastric cancer tissue using CD25 Rabbit pAb (A2984) at a dilution of 1:25 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using CD25 Rabbit pAb (A2984) at a dilution of 1:25 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - CD25 Rabbit pAb (A2984)

Immunofluorescence analysis of paraffin-embedded Human spleen tissue using CD25 Rabbit pAb (A2984) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Flow CytoMetry - CD25 Rabbit pAb (A2984)

Flow cytometry: 293F Transfection cells(+) and 293F cells(-) were stained with Rabbit IgG isotype control (AC042, 10 μg/mL, blue line) or CD25 Rabbit pAb (A2984, 2.5μg/mL orange line), followed by Goat anti-Rabbit pAb Alexa Fluor 647 (AS086, 1:600 dilution) staining. Non-fluorescently stained Daudi cells was used as blank control (red line).

Overview

Product name	CD25 Rabbit pAb
Catalog No.	A2984
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency. Patients with severe Coronavirus Disease 2019 (COVID-19), the disease caused by the novel severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), have significantly elevated levels of IL2R in their plasma. Similarly, serum IL-2R levels are found to be elevated in patients with different types of carcinomas. Certain IL2RA and IL2RB gene polymorphisms have been associated with lung cancer risk.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 101-200 of human CD25 (NP_000408.1).
Sequence	QKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
Gene ID
Swiss Prot
Synonyms	p55; CD25; IL2R; IMD41; TCGFR; IDDM10
Calculated MW	31kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 FC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Flow Cytometry
Positive samples	Rat spleen, Rat lung
Cellular location	Membrane, Single-pass type I membrane protein.