제품 > 항체 > 다중클론항체(pAb)

CD71/Transferrin Receptor Rabbit pAb (A21622)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HeLa cells, using CD71/Transferrin Receptor Rabbit pAb (A21622) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from Rat spleen, using CD71/Transferrin Receptor Rabbit pAb (A21622) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunofluorescence - CD71/Transferrin Receptor Rabbit pAb (A21622)

Immunofluorescence analysis of L929 cells using CD71/Transferrin Receptor Rabbit pAb (A21622) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - CD71/Transferrin Receptor Rabbit pAb (A21622)

Immunoprecipitation analysis of 200 μg extracts of Jurkat cells using 3 μg CD71/Transferrin Receptor antibody (A21622). Western blot was performed from the immunoprecipitate using CD71/Transferrin Receptor antibody (A21622) at a dilution of 1:1000.

Overview

Product name	CD71/Transferrin Receptor Rabbit pAb
Catalog No.	A21622
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71/Transferrin Receptor (NP_003225.2).
Sequence	RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV
Gene ID
Swiss Prot
Synonyms	T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46; CD71/Transferrin Receptor
Calculated MW	85kDa
Observed MW	90kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, Rat spleen
Cellular location	Cell membrane, Melanosome, Secreted, Single-pass type II membrane protein.
Customer validation	WB(Homo sapiens, Other, Cyprinus carpio)