제품 > 항체 > 단일클론항체(mAb)

[KD Validated] DNMT1 Rabbit mAb (A19679)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KD Validated] DNMT1 Rabbit mAb (A19679) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 30 s.

Western blot analysis of lysates from wild type (WT) and DNMT1 knockdown (KD) 293T cells, using [KD Validated] DNMT1 Rabbit mAb (A19679) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - [KD Validated] DNMT1 Rabbit mAb (A19679)

Immunoprecipitation of DNMT1 from 300 µg extracts of Jurkat cells was performed using 3 µg of DNMT1 Rabbit mAb (A19679). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using DNMT1 Rabbit mAb (A19679) at a dilution of 1:1000.

Overview

Product name	[KD Validated] DNMT1 Rabbit mAb
Catalog No.	A19679
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51348

Background

This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1).
Sequence	MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN
Gene ID
Swiss Prot
Synonyms	AIM; DNMT; MCMT; CXXC9; HSN1E; ADCADN; m.HsaI; [KD Validated] DNMT1
Calculated MW	183kDa
Observed MW	200kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	Jurkat, HeLa, 293T
Cellular location	Nucleus.
Customer validation	IF(Mus musculus) WB(Gallus gallus) ChIP(mus musculus)