제품 > 항체 > 다중클론항체(pAb)

SEMA4D Rabbit pAb (A10136)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from 293T cells, using SEMA4D Rabbit pAb (A10136) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

Overview

Product name	SEMA4D Rabbit pAb
Catalog No.	A10136
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables identical protein binding activity; semaphorin receptor binding activity; and transmembrane signaling receptor activity. Involved in several processes, including positive regulation of phosphatidylinositol 3-kinase signaling; regulation of neuron projection development; and regulation of phosphate metabolic process. Is integral component of plasma membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 753-862 of human SEMA4D (NP_006369.3).
Sequence	YNCYKGYLPRQCLKFRSALLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD
Gene ID
Swiss Prot
Synonyms	A8; GR3; BB18; CD100; COLL4; SEMAJ; coll-4; C9orf164; M-sema-G; SEMA4D
Calculated MW	96kDa
Observed MW	150kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T
Cellular location	Cell membrane, Single-pass type I membrane protein
Customer validation	WB(Oryctolagus cuniculus, Homo sapiens, Mus musculus)