Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | STAT3 Rabbit mAb |
---|---|
Catalog No. | A22434 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2576 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT3 (P40763). |
---|---|
Sequence | MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPME |
Gene ID | |
Swiss Prot | |
Synonyms | APRF; HIES; ADMIO; ADMIO1; STAT3 |
Calculated MW | 88kDa |
Observed MW | 86kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | Rat brain |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | IF(Mus musculus, Homo sapiens) WB(Homo sapiens, Mus musculus, Rattus norvegicus) ChIP(Homo sapiens) WB(Homo sapiens) qPCR(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22434? Please let us know so that we can cite the reference in this datasheet.