Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | c-Jun Rabbit pAb |
---|---|
Catalog No. | A11378 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-70 of human c-Jun (NP_002219.1). |
---|---|
Sequence | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK |
Gene ID | |
Swiss Prot | |
Synonyms | AP1; p39; AP-1; cJUN; c-Jun |
Calculated MW | 36kDa |
Observed MW | 43kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, NIH/3T3, MCF7, Mouse lung, Mouse heart, Rat kidney |
Cellular location | Nucleus. |
Customer validation | IHC(Mus musculus, Homo sapiens, Cervus nippon) WB(Mus musculus, Homo sapiens) RNA-Seq(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11378? Please let us know so that we can cite the reference in this datasheet.