제품 > 항체 > 단일클론항체(mAb)

APC Rabbit-anti Human CD3 mAb (A27111)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Raji cells (negative control, left) and Human PBMC (right) were surface-stained with APC Rabbit-anti Human CD3 mAb (A27111, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line). Cells in the lymphocyte gate were used for analysis.

Flow cytometry: 1X10^6 Human PBMC were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit-anti Human CD3 mAb (A27111, 5 μl/Test, right). Cells in the lymphocyte gate were used for analysis.

Overview

Product name	APC Rabbit-anti Human CD3 mAb
Catalog No.	A27111
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68274-APC

Background

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human CD3 (NP_000724.1).
Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Gene ID
Swiss Prot
Synonyms	T3E; TCRE; IMD18; CD3epsilon
Calculated MW	23kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein.