제품 > 항체 > 다중클론항체(pAb)

CD3E Antigen Rabbit pAb (A12415)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CD3E Antigen Rabbit pAb (A12415) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - CD3E Antigen Rabbit pAb (A12415)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using CD3E Antigen Rabbit pAb (A12415) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse thymus using CD3E Antigen Rabbit pAb (A12415) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CD3E Antigen Rabbit pAb (A12415)

Immunofluorescence analysis of Jurkat cells using CD3E Antigen Rabbit pAb (A12415) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of RAW264.7 cells using CD3E Antigen Rabbit pAb (A12415) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	CD3E Antigen Rabbit pAb
Catalog No.	A12415
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 111-207 of human CD3E (NP_000724.1).
Sequence	YLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Gene ID
Swiss Prot
Synonyms	T3E; TCRE; IMD18; CD3epsilon; CD3E Antigen
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Jurkat, Rat thymus
Cellular location	Cell membrane, Single-pass type I membrane protein
Customer validation	IF(Mus musculus)