제품 > 항체 > 단일클론항체(mAb)

Alpha-synuclein Truncation 1-119 mAb [MJFF-C-24D2] (A27453)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Confocal imaging of Mouse primary hippocampal neuron cells(treated with Alpha-Synuclein Fibrils) and Mouse primary hippocampal neuron cells(treated with PBS) using Alpha-synuclein Truncation 1-119 mAb [MJFF-C-24D2] (A27453, dilution 1:1000) followed by a further incubation with Goat anti-Rabbit IgG (H+L), AlexaFluor 488 (A-11034, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 60x.

Overview

Product name	Alpha-synuclein Truncation 1-119 mAb [MJFF-C-24D2]
Catalog No.	A27453
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC5168

Background

Target background: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Alpha-synuclein is a neuronal protein that plays many roles in synaptic activity such as membrane trafficking of synaptic vesicles and neurotransmitter release. Multiplications in SNCA have been implicated in genetic forms of Parkinson disease and pathological post-translational modifications of alpha-synuclein are a hallmark of Parkinson’s disease. These modifications include phosphorylation, nitration, acetylation, truncation, and aggregation. C-terminal truncations of alpha-synuclein lead to increased aggregation. Evidence for the 1-119 truncation in brains of patients with Parkinson’s disease, Lewy Body Dementia (LBD), Multiple Systems Atrophy (MSA), and Alzheimer’s disease.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human alpha-synuclein(NP_000336.1).
Sequence	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVD
Gene ID
Swiss Prot
Synonyms	PD1; NACP; PARK1; PARK4
Calculated MW	14kDa
Observed MW	14kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:5000 - 1:30000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples
Cellular location	Cell junction, Cytoplasm, Membrane, Nucleus, Secreted, cytosol, synapse, Cell projection, axon.