Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Alpha-synuclein Truncation 1-122 mAb [MJFF-D-10B7] |
---|---|
Catalog No. | A27452 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC5167 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human alpha-synuclein(NP_000336.1). |
---|---|
Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDN |
Gene ID | |
Swiss Prot | |
Synonyms | PD1; NACP; PARK1; PARK4 |
Calculated MW | 14kDa |
Observed MW | Refer to figures |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | |
Positive samples | |
Cellular location | Cell junction, Cytoplasm, Membrane, Nucleus, Secreted, cytosol, synapse, Cell projection, axon. |
* For research use only. Not for therapeutic or diagnostic purposes.